PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00023.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 359aa    MW: 40728.2 Da    PI: 9.4691
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00023.1_g00015.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.71e-072062431754
                              HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                              A+rsR RK+++i eLe+ v++L+ae ++   el+ l++
  Rsa1.0_00023.1_g00015.1 206 AQRSRVRKLQYISELERNVQSLQAEGSKVSAELDFLNQ 243
                              89*************************99999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0083193254IPR004827Basic-leucine zipper domain
CDDcd147035.68E-15198245No hitNo description
Gene3DG3DSA:1.20.5.1702.7E-7206248No hitNo description
SuperFamilySSF579591.13E-5206248No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MAGTKGSESV RSLMYPGKSA LLPPKIPFPS VSASYSDYVP CGSRQGHKVS IEKAHHHHHH  60
HHHHHHQRTS SESHLVEELP FWLDDLLNEP ESPASRKSGH RRSASDSYAY LDVSNATNLT  120
DFSSRNQVSS IQRGIQESQD ASFYADSSFL KQRSRQLVPS GPPLPSWLPS TGASYMSQDA  180
TADYAEAQPV TYEADNNTKR AKQQFAQRSR VRKLQYISEL ERNVQSLQAE GSKVSAELDF  240
LNQRNLILSM ENKALKHRLE SIAQEKLIKQ LEQEVLEREI GRLRALFQQQ QQQQHTRQQS  300
ASHKRATSKD LDSQFSSLSL NAKDSNCRRD SLSVMGQFHF YAPGFHYLKT YNSSSIWLA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013655769.11e-168PREDICTED: uncharacterized protein At4g06598-like
TrEMBLA0A078GFA61e-168A0A078GFA6_BRANA; BnaA01g21580D protein
STRINGAl_scaffold_0002_6821e-166(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33602444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-159bZIP family protein